ad servers today
Is this serious?
I actually did not realize how boggy the internet has become until, after years, i turned off the script blockers out of curiosity and visited a random mainstream website. It was rather disturbing. It takes quite some effort to dive into this topic, and the extent and complexity of interconnected ad and profilig networks is simply crazy and probably out of control.
Just an example
Here’s the roundup of about 90 newspaper and magazine websites. They have been chosen using public (ad-related) databases with the restriction to have at least 50,000 printed copies per issue and, of course, a website. They needed to be matched by name across two databases and this is what came out. Some websites have been added by hand. (source code and notebook)
On each site, Alice
- clicked the yes-accept-all-just-leave-me-alone button
- scrolled the page down to the bottom
- clicked one article and scrolled about
The following table is conveniently ordered by third parties, but can be ordered in any way you like if javascript is enabled. Third-party means anything that got requested by the browser which is from a different domain name than the actual website. To be honest, i did not distinguish between first-party CDN and true third-party requests because it would require manual examination and it was tiring enough to browse through all the pages in the first place.
(If you think one should write a script that reliably clicks the accept-all button on all pages that have one, you’re welcome to join efforts. For some reason it’s made very hard)
- shareholders: Number of shareholders with at least 1% of capital share
- third parties: Number of networks requested that are not the main server
- requests: Number of network requests during the visit of the website
- tp-requests: Number of network requests to third-party servers during the visit of the website
- tp-requests %: Percent of network request to third-party servers compared to first-party servers
So imagine, there are people just using their browser as-is, reading an article in the Saarbrücker Zeitung and tell over a hundred other networks or companies what they are doing.
What exactly happens there is subject of more research but the majority of those third-party requests can be attributed to ads/header bidding and profiling. You can type these words into the major search engine and it will gladly invite you with tutorials and documentation to setup these amazing technologies on your own page. My humble understanding at the moment is that whenever a browser displays one of those websites it screams out:
“I have these blank spaces in between my articles! Anybody any ad you wanna display? Let’s say for a dollar per click?”
Eventually a third-party ad exchange network will deliver a piece of html that contains an ad. The website runner is called the publisher, the blank spaces are inventory and it’s sold to advertisers which in turn work on behalf of the brands. And because it’s all done algorithmically it’s called programmatic.
For quite some time, the waterfall method was the widely used method for maximizing income of all participants in the advertising process.
“Does my trusted first-party ad supplier has an ad for this user? No? Well, how about my second-loveliest worldwide-top-ads supplier? A dollar, great!”
This method was argued to be a bit slow. Also, the publisher may miss ads for a higher price by not looking into the 5th remnant-crap-exchange. So it got gradually replaced by organizing auctions:
“Hey everyone! Anybody an ad? Floor price one dollar. Oh, you there would pay 1.20? Congratulations! Now gimme that ad.”
And why would anyone pay those 1.20? Because it’s a well measured prosperous website. Because an ad might perfectly fit to the content of the visited page or sub-page and therefore must generate a high level of leads. And because something in all the data bits transmitted from the browser to the advertisers tells them which ad might be most successful for the particular and potential customer using the browser. This is archived by the even more complicated and mysterious art of profiling and combination of several first-party publisher data with whatever else can be collected and attributed to a digital identity.
So here’s already a good explanation for most of the thrird-party web traffic: The more, the better!
Advertisers and exchangers are a bit concerned since a couple of years because publishers not only relied on the bidding process of exchange networks to deliver the best ads for the best price but they actually started to waterfall the exchanges:
“Hey, would someone please run an auction at 2 dollars? Nothing today? Well, i was just thinking, maybe someone had the perfect ad for this identity. 1.75 then? Great! I’ll keep your ad for the moment and just run another auction to make sure..”
And most of this happens in the browser, not on the publisher’s server. In part you can even see the prices for the delivered ads when reading through the network log.
The list of all third-party networks is below.
remark about shareholders
The shareholders column in above table shows the number of shareholders with at least 1% of capital share. This data is compiled by an institution called Kommission zur Ermittlung der Konzentration im Medienbereich (KEK). For example, you can look up the ownership of Saarbrücker Zeitung on their interactive webpage. They also have an undocumented API where the shareholder data was scraped from. There’s only six websites/papers in my dataset which are not covered by the KEK data. They have zero shareholders in the table.
Here is a complete shareholder graph for the mentioned paper:
(online) www.saarbruecker-zeitung.de
└─Saarbrücker Zeitung Verlag und Druckerei GmbH
├─56.07 Rheinisch-Bergische Verlagsgesellschaft mbH
│ ├─21.92 Befa Beteiligungs-GmbH
│ │ ├─22.1 Merz-Betz, Florian
│ │ ├─11.25 Merz, Thomas
│ │ ├─11.25 Sader-Merz, Caroline
│ │ ├─11.25 Merz, Esther
│ │ ├─7.0 Stilz, Clara
│ │ ├─7.0 Stilz, Leoni
│ │ ├─6.0 Berger, Sarina
│ │ ├─6.0 Berger, Viola
│ │ ├─6.0 Berger, Thalita
│ │ ├─5.35 Stilz, Markus
│ │ ├─3.95 Stilz, Andreas
│ │ ├─1.85 Stilz, Eva
│ │ └─1.0 Betz, Esther
│ ├─20.87 Wenderoth GmbH & Co KG
│ │ ├─24.75 Ebel, Martin
│ │ ├─24.75 Ebel, Stefan
│ │ ├─24.75 Ebel, Johannes
│ │ ├─24.75 Breitkreutz, Elisabeth
│ │ ├─1.0 Wenderoth-Alt, Irene
│ │ └─0.0 Wenderoth Verwaltungs-GmbH
│ ├─9.9 Büro Dr. M. Droste GmbH & Co KG
│ │ ├─89.6 Droste, Manfred
│ │ ├─2.6 Droste, Tilman
│ │ ├─2.6 Droste-Zobel, Lieselotte
│ │ ├─2.6 Droste, Alexander
│ │ ├─2.6 Droste, Felix
│ │ └─0.0 Dr. M. Droste Verwaltungs GmbH
│ ├─6.12 Girardet Verlag KG
│ │ ├─35.8 Girardet, Klaus
│ │ ├─28.0 Girardet, Rainer
│ │ ├─12.2 Rheinische Post Verlagsgesellschaft mbH
│ │ │ └─100.0 Rheinisch-Bergische Verlagsgesellschaft mbH
│ │ │ └─...
│ │ ├─8.2 Girardet, Nikolaus
│ │ ├─8.2 Girardet, Isabelle
│ │ ├─2.6 Girardet-Seiffert, Annette
│ │ ├─2.6 Böhmer, Bärbel
│ │ ├─2.6 Joens-Girardet, Christina
│ │ ├─0.0 Girardet Verlag Verwaltungs GmbH
│ │ └─0.0 Girardet, Dr. Michael
│ ├─4.28 Lohse, Stephan
│ ├─4.16 Klostermann, Thomas
│ ├─4.16 Seifert, Katja
│ ├─3.33 Droste, Tilman
│ ├─3.33 Droste-Zobel, Lieselotte
│ ├─3.33 Droste, Alexander
│ ├─3.33 Droste, Felix
│ ├─3.1 Arnold, Philipp
│ ├─3.1 Arnold, Dr. Karl Hans
│ ├─2.5 Lohse, Julia
│ ├─2.5 Lohse, Benedikt
│ ├─1.58 Rauert, Stephanie
│ ├─0.97 Seifert, Felix
│ ├─0.51 Rauert, Annabelle
│ ├─0.51 Rauert, Konstantin
│ └─0.51 Rauert, Robert
├─27.86 Gesellschaft für staatsbürgerliche Bildung Saar mbH
│ ├─40.0 Union Stiftung e.V.
│ ├─40.0 Demokratische Gesellschaft Saarland e. V.
│ └─20.0 Villa Lessing Liberale Stiftung Saar e.V.
└─16.07 Beteiligungsgesesellschaft Saarbrücker Zeitung GbR
└─100.0 ca. 1.000 Mitarbeiter der Unternehmensgruppe Saarbrücker Zeitung
On first inspection i thought the number of shareholders is somehow related to the number of third-party servers but apart from the marketing outliers on the left side there does not seem to be a tight relation.
It would be interesting to inspect individual ownerships related to individual third party companies but right now i’m still trying to figure out how to make a blog post with so much interactive data.
third parties
The following table lists all third party servers from the dataset, which are over 500. I do not know about an ownership database for these kind of servers except search engines and whois servers. The latter ones do actually not allow anything with that data except checking for validity of domain names. In the course of privacy enhancements in the internet the whois-information is now largly hidden from public access. Especially in europe. Especially in germany. I align with the call for privacy of individuals in the face of evil programmatic exploitation by experts and fraudsters and all that, but why should they hide the registrant organization of google.de? That does not make me feel safer. Anyways, since the whois-data is now redacted for privacy i will just include what i got from the individual servers.
- registrant: The registrant country and name - the organisation that registered the domain name
- network: The country and name of the network operator of the IP
- websites: Number of websites where this network was used
- websites %: Percentage of all visited websites where this network was used
- requests: Percentage of network requests this server received during all visits
- article_referer: The number requests that contained the URL of a visited article as 'Referer' header
- bytes_sent: The number of bytes sent to this server during all visits (via query parameters and POST data)
- bytes_received: The number of bytes received from this server during all visits
the complete matrix
The tables provide some overview and the matrix below provides us with the actual facts of who used whom. You can hover over the heatmap to see the names. X is website, Y is third party.
I’d like to leave the reader alone now in her/his attempts to detect structure and find understanding in all this.
oh, you made it this far?
Just one more puzzle piece.
Mit der anonymen Messung bieten wir Ihnen das optimale Fundament, um Ihre Nutzungswerte mit 100% Datenschutzkonformität – ohne Opt-In-Pflicht – zuverlässig zu erheben.
That’s what https://www.infonline.de/ explains. They are behind ioam.de which lurks on over 70 websites in this dataset. So here is one of the scripts they deliver. In constrast to most other scripts it is not obfuscated. ‘Guess because they are 100% data protecion compliant.
https://script.ioam.de/iam.js
/*DO NOT HOST THIS SCRIPT ON YOUR OWN SERVER*/
var szmvars = "";
(function(global) {
var iomnames = "iom".split(',') || ['iom'];
iomnames = iomnames.length > 4 ? iomnames.slice(0, 3) : iomnames;
for (var i = 0, iLen = iomnames.length; i < iLen; i +=1) {
global[iomnames[i]] = (function () {
var dummySite = "dummy",
baseUrlDE = "de.ioam.de/tx.io",
baseUrlLSO = "de.ioam.de/aid.io",
optinUrl = "de.ioam.de/optin.php?re=",
qdsUrl = "irqs.ioam.de",
deBaseUrl = ".ioam.de/tx.io",
deBaseUrlLSO = ".ioam.de/aid.io",
deOptinUrl = ".ioam.de/optin.php?re=",
deSubdomain = ["imarex"],
cntBaseUrl = ".iocnt.net/tx.io",
cntBaseUrlLSO = ".iocnt.net/aid.io",
cntOptinUrl = ".iocnt.net/optin.php?re=",
cntQdsUrl = "irqs.iocnt.net",
cntSubdomain = ["at"],
eventList = ["", "inst", "init","open", "clse", "play", "resm", "stop", "fowa", "bakw", "recd", "paus", "forg", "bakg", "dele", "refr", "kill", "view", "alve", "fini", "mute", "aforg", "abakg", "aclse", "sple", "scvl", "serr", "spyr", "smdr", "sfpl", "sfqt", "ssqt", "stqt", "soqt", "sofc", "scfc", "scqt", "splr", "spli", "sprs", "spre", "smrs", "smre", "sors", "sore", "sack", "sapl", "sapa", "snsp"],
LSOBlacklist = [],
checkEvents = 1,
tb = 0,
sv = 1,
lastEvent = "",
emptyCode = "Leercode_nichtzuordnungsfaehig",
autoEvents = {
onfocus:"aforg",
onblur:"abakg",
onclose:"aclse"
},
nt = 2,
cookiewhitelist = '[]'.match(/[A-Za-z0-9]+/g) || [],
cookieName = "ioam2018",
cookieMaxRuns = 0,
socioToken = "9103153f604dfc245e460102ec6ec60b",
OptoutCookieName = "ioamout",
frequency = 60000,
hbiAdShort = 5000,
hbiAdMedium = 10000,
hbiAdLong = 30000,
hbiShort = 10000,
hbiMedium = 30000,
hbiLong = 60000,
hbiExtraLong = 300000,
heart,
maxSendBoxes = 10;
var IAMPageElement = null,
IAMQSElement = null,
qdsParameter = {},
qdsPopupBlockDuration = 86400000,
result = {},
mode,
eventsEnabled = 0,
surveyCalled = 0,
inited = 0;
var lsottl = 86400000,
lsottlmin = 180000,
ioplusurl = "me.ioam.de";
var fpCookieDomain = getFpcd(location.hostname),
consentVendors = ('[730, 785]'.match(/[0-9]+/g) || []).map(function(vendor) { return parseInt(vendor, 10) }),
consentMaxCheckIntervals = parseInt('10', 10) || 10,
consentCheckIntervalLength = parseInt('60', 10) || 60,
cmpUiShownHandler = false,
consentCookieExpire = new Date();
consentCookieExpire.setDate(28);
var consentCookieOptions = {
name: 'iom_consent',
domain: fpCookieDomain.length > 0 ? fpCookieDomain.slice(7, fpCookieDomain.length - 1) : '',
expires: consentCookieExpire.toUTCString(),
path: '/'
};
function setConsent(ct) {
processConsent(ct, { vendors: consentVendors, cookie: consentCookieOptions, resultKey: 'ct' }, result);
}
function loadConsentFromCookie(options) {
var value = '';
var date;
var valueMatch = document.cookie.match(new RegExp('(^| )' + options.name + '=([^;]+)'));
var valueParts;
if (valueMatch) {
valueParts = valueMatch[2].split('&');
value = valueParts[0];
date = valueParts[1];
}
return {
value: value,
date: date
};
}
function writeConsentToCookie(consent, options) {
var now = Date.now();
var cookie = '';
Object.keys(options).forEach(function(key, index, keys) {
var option = options[key];
if (key === 'name') {
cookie += option + '=' + consent + '&' + now;
cookie += index < keys.length ? '; ' : ''
} else {
if (option) {
cookie += key + '=' + option;
cookie += index < keys.length ? '; ' : ''
}
}
})
document.cookie = cookie;
}
function checkForConsent(consentString, vendors, vendor, purpose,offset) {
var result = false;
if (typeof consentString === 'string' && consentString.length === 2 + vendors.length * 4) {
var vendorIndex = vendors.indexOf(vendor);
if (vendorIndex > -1) {
var start = 2;
var end = start + ((vendorIndex + 1) * 4);
var consentVendorPart = parseInt(consentString.slice(start, end), 16);
var purposeBit = Math.pow(2, (purpose + offset));
result = (consentVendorPart & purposeBit) === purposeBit;
}
}
return result;
}
function processConsent(consentString, consentOptions, iamResultSet) {
function extractConsentFromCmp(tcData, vendors) {
function extractPurposes(vendor, hasLegitimateInterest, hasSpecialFeatureOptins) {
function filter(data) {
return function(value) {
return data[value] === true;
};
}
function mapper(offset) {
return function(value) {
var exp = (parseInt(value) + offset);
return Math.pow(2, exp);
};
}
function merge(purposes1, purposes2) {
return purposes1.concat(purposes2.filter(function(item) {
return purposes1.indexOf(item) < 0;
}));
}
var purposes;
var legitimateInterests = [];
purposes = Object
.keys(tcData.purpose.consents)
.filter(filter(tcData.purpose.consents))
.map(mapper(-1));
if (hasLegitimateInterest) {
legitimateInterests = Object
.keys(tcData.purpose.legitimateInterests)
.filter(filter(tcData.purpose.legitimateInterests))
.map(mapper(-1));
}
if (legitimateInterests.length > 0) {
purposes = merge(purposes, legitimateInterests);
}
if (hasSpecialFeatureOptins) {
purposes = purposes.concat(Object.keys(tcData.specialFeatureOptins)
.filter(filter(tcData.specialFeatureOptins))
.map(mapper(9)));
}
return purposes;
}
function createPurposesBitfield(purposes) {
var result = 0x0000;
for (var i = 0, iLen = purposes.length; i < iLen; i += 1) {
result |= purposes[i];
}
return result;
}
function convertToConsentString(consent) {
function padStart(str, size) {
while (str.length < size) {
str = '0' + str;
}
return str;
}
var result = '';
for (var i = 0, iLen = consent.length; i < iLen; i += 1) {
var hex = consent[i].toString(16);
var hexLen = 4;
if (i === 0) {
hexLen = 2;
}
hex = padStart(hex, hexLen);
result += hex;
}
return result;
}
var consent = [0x01];
for (var i = 0, iLen = vendors.length; i < iLen; i += 1) {
var vendor = vendors[i];
if (tcData.vendor.consents[vendor] === true || tcData.vendor.legitimateInterests[vendor] === true) {
var purposes = [];
var hasLegitimateInterests = tcData.vendor.legitimateInterests[vendor];
var hasSpecialFeaturesOptins = Object.keys(tcData.specialFeatureOptins).length > 0;
purposes = extractPurposes(vendors[i], hasLegitimateInterests, hasSpecialFeaturesOptins);
consent.push(createPurposesBitfield(purposes));
} else {
consent.push(0x0000);
}
}
return convertToConsentString(consent);
}
function createDefaultConsentString(vendors, hasApi) {
var result = '';
for(var i = 0, iLen = vendors.length; i < iLen; i += 1) {
result += '0000';
}
result = (hasApi ? '01' : '00') + result;
return result;
}
function handleConsentLoaded(currentConsentString, options, resultSet) {
return function(tcData, success) {
var noop = function() {};
if (success && ['tcloaded', 'useractioncomplete'].indexOf(tcData.eventStatus) > -1) {
var extractedConsentString = tcData.gdprApplies
? extractConsentFromCmp(tcData, options.vendors)
: createDefaultConsentString(options.vendors, true);
if (extractedConsentString !== currentConsentString) {
if (resultSet && options.resultKey) {
resultSet[options.resultKey] = extractedConsentString;
}
writeConsentToCookie(extractedConsentString, consentOptions.cookie);
}
__tcfapi('removeEventListener', 2, noop, tcData.listenerId);
} else {
var failedConsentString = createDefaultConsentString(options.vendors, true);
if (resultSet && options.resultKey) {
resultSet[options.resultKey] = failedConsentString;
}
writeConsentToCookie(failedConsentString, consentOptions.cookie);
}
};
}
function handleCmpUiShown(currentConsentString, options, resultSet) {
return function(tcData, success) {
if (success && tcData.eventStatus === 'cmpuishown') {
__tcfapi('addEventListener', 2, handleConsentLoaded(currentConsentString, options, resultSet));
}
}
}
function hasTcfApi() {
return '__tcfapi' in window;
}
var interval = 0;
var intervalCount = 0;
var storedConsentString = loadConsentFromCookie(consentOptions.cookie).value;
var defaultConsentString = createDefaultConsentString(consentOptions.vendors, hasTcfApi());
if (hasTcfApi()) {
if (iamResultSet && consentOptions.resultKey) {
iamResultSet[consentOptions.resultKey] = storedConsentString || defaultConsentString;
}
__tcfapi('addEventListener', 2, handleConsentLoaded((storedConsentString || defaultConsentString), consentOptions, iamResultSet));
if (cmpUiShownHandler === false) {
__tcfapi('addEventListener', 2, handleCmpUiShown((storedConsentString || defaultConsentString), consentOptions, iamResultSet));
cmpUiShownHandler = true;
}
} else if (!hasTcfApi()){
interval = setInterval(function() {
intervalCount += 1;
if (hasTcfApi() || intervalCount >= consentMaxCheckIntervals) {
clearInterval(interval);
processConsent(consentString, consentOptions, iamResultSet);
}
}, consentCheckIntervalLength);
}
if (consentString && consentString !== storedConsentString && hasTcfApi() === false) {
writeConsentToCookie(consentString, consentOptions.cookie);
if (iamResultSet && consentOptions.resultKey) {
iamResultSet[consentOptions.resultKey] = consentString;
}
} else if (!consentString && storedConsentString && hasTcfApi() === false) {
if (iamResultSet && consentOptions.resultKey) {
iamResultSet[consentOptions.resultKey] = storedConsentString;
}
} else if (!consentString && !storedConsentString && hasTcfApi() === false) {
writeConsentToCookie(defaultConsentString, consentOptions.cookie);
if (iamResultSet && consentOptions.resultKey) {
iamResultSet[consentOptions.resultKey] = defaultConsentString;
}
}
}
function enableEvents() {
if ((tb == 1 || result.tb == "on") && result.tb != "off" && !eventsEnabled) {
eventsEnabled = 1;
mode = 1;
for(var e in autoEvents) {
(function(e) {
var oldEvent = window[e];
window[e] = function() {
if (lastEvent != autoEvents[e]) {
lastEvent = autoEvents[e];
event(autoEvents[e]);
}
if (typeof oldEvent == "function") oldEvent();
};
})(e);
}
}
}
function isDoNotTrack() {
if ((nt & 2) ? ((typeof result.nt == "undefined") ? (nt & 1) : result.nt) : nt & 1) {
if (window.navigator.msDoNotTrack && window.navigator.msDoNotTrack == "1") return true;
if (window.navigator.doNotTrack && (window.navigator.doNotTrack == "yes" || window.navigator.doNotTrack == "1")) return true;
}
return false;
}
var getInvitation = function (response) {
if (response && response.hasOwnProperty("block-status")){
var isEligibleForInvitation = ( "NONE" === response['block-status'].toUpperCase() );
if (isEligibleForInvitation) {
if (IAMQSElement) {
IAMQSElement.parentNode.removeChild(IAMQSElement);
}
IAMQSElement = createScriptTag(response['invite-url']);
}
}
};
function loadSurvey() {
szmvars = result.st + "//" + result.pt + "//" + result.cp + "//VIA_SZMNG";
var sampleType = (result.sv == "i2") ? "in" : result.sv;
var qdsHost = qdsUrl;
if (result.cn) {
sampleType += "_"+result.cn;
if (result.cn == "at") {
qdsHost = cntQdsUrl;
}
}
qdsParameter = {
siteIdentifier: result.cp,
offerIdentifier: result.st,
sampleType: sampleType,
pixelType: result.pt,
contentType: result.cp,
host: qdsHost,
port: "",
isFadeoutFlash: true,
isFadeoutFrame: true,
isFadeoutForm: true,
positionTop: 10,
positionLeft: 100,
zIndex: 1100000,
popupBlockDuration: qdsPopupBlockDuration,
keysForQueryParam : [
"offerIdentifier",
"siteIdentifier",
"sampleType",
"pixelType",
"isFadeoutFlash",
"isFadeoutFrame",
"isFadeoutForm",
"positionTop",
"positionLeft",
"zIndex"]
};
if(typeof window.iam_zindex !== 'undefined') {
qdsParameter.zIndex = window.iam_zindex;
}
if(typeof window.iam_fadeout_flash !== 'undefined') {
qdsParameter.isFadeoutFlash = window.iam_fadeout_flash;
}
if(typeof window.iam_fadeout_iframe !== 'undefined') {
qdsParameter.isFadeoutFrame = window.iam_fadeout_iframe;
}
if(typeof window.iam_fadeout_form !== 'undefined') {
qdsParameter.isFadeoutForm = window.iam_fadeout_form;
}
if(typeof window.iam_position_top !== 'undefined') {
qdsParameter.positionTop = window.iam_position_top;
}
if(typeof window.iam_position_left !== 'undefined') {
qdsParameter.positionLeft = window.iam_position_left;
}
var filterObjectByKeys = function (obj, keysToFilter) {
var result = {}, key;
var arrayLength = keysToFilter.length;
for (var i = 0; i < arrayLength; i++) {
key = keysToFilter[i];
if (obj.hasOwnProperty(key)) {
result[key] = obj[key];
}
}
return result;
};
var serializeToQueryString = function (obj) {
var str = [];
for (var key in obj)
if (obj.hasOwnProperty(key)) {
str.push(encodeURIComponent(key) + "=" + encodeURIComponent(obj[key]));
}
return str.join("&");
};
var createPopupcheckCookie = function (blockDuration) {
var blockedUntilDate = new Date();
blockedUntilDate.setTime(blockedUntilDate.getTime() + blockDuration);
var expires = "expires=" + blockedUntilDate.toUTCString();
document.cookie = "POPUPCHECK=" + blockedUntilDate.getTime().toString() + ";" + expires + ";path=/";
};
var hasPopupcheckCookie = function () {
var cookie = document.cookie.split(";");
for (var i = 0; i < cookie.length; i++) {
if (cookie[i].match("POPUPCHECK=.*")) {
var currentDate = new Date();
var now = currentDate.getTime();
currentDate.setTime(cookie[i].split("=")[1]);
var blockedUntilTime = currentDate.getTime();
if (now <= blockedUntilTime) {
return true;
}
}
}
return false;
};
if (hasPopupcheckCookie()) {
return;
}
if (sv && !surveyCalled && result.sv !== "ke" && result.sv === "dz") {
surveyCalled = 1;
iam_ng_nxss();
}
if (sv && !surveyCalled && result.sv !== "ke" && (result.sv === "in" || result.sv === "mo" || result.sv === "i2" )) {
surveyCalled = 1;
createPopupcheckCookie(qdsParameter.popupBlockDuration);
// var protocol = window.location.protocol;
var protocol = "https:";
var pathOfCheckInvitation = "identitystatus";
var queryParameter = filterObjectByKeys(qdsParameter, qdsParameter.keysForQueryParam);
var queryParameterString = "?" + serializeToQueryString(queryParameter);
if (window.XDomainRequest && document.documentMode === 9) {
var checkForInvitationUrl = protocol + '//' + qdsParameter.host + '/' + pathOfCheckInvitation + '/identity.js' + queryParameterString+'&callback=iom.gi&c='+Math.random();
createScriptTag(checkForInvitationUrl);
} else {
var checkForInvitationUrl = protocol + '//' + qdsParameter.host + '/' + pathOfCheckInvitation + queryParameterString+'&c='+Math.random();
var httpRequest = new XMLHttpRequest();
httpRequest.onreadystatechange = function () {
if (httpRequest.readyState === XMLHttpRequest.DONE && 200 === httpRequest.status) {
var response = JSON.parse(httpRequest.responseText);
getInvitation(response);
}
};
httpRequest.open('GET', checkForInvitationUrl, true);
httpRequest.withCredentials = true;
httpRequest.send(null);
}
}
}
function hash(key) {
var hash = 0;
for (var i=0; i<key.length; ++i) {
hash += key.charCodeAt(i);
hash += (hash << 10);
hash ^= (hash >> 6);
}
hash += (hash << 3);
hash ^= (hash >> 11);
hash += (hash << 15);
hash = Math.abs(hash & hash);
return hash.toString(36);
}
function activeXDetect() {
var result = "",
componentVersion,
components =[
"7790769C-0471-11D2-AF11-00C04FA35D02", "89820200-ECBD-11CF-8B85-00AA005B4340",
"283807B5-2C60-11D0-A31D-00AA00B92C03", "4F216970-C90C-11D1-B5C7-0000F8051515",
"44BBA848-CC51-11CF-AAFA-00AA00B6015C", "9381D8F2-0288-11D0-9501-00AA00B911A5",
"4F216970-C90C-11D1-B5C7-0000F8051515", "5A8D6EE0-3E18-11D0-821E-444553540000",
"89820200-ECBD-11CF-8B85-00AA005B4383", "08B0E5C0-4FCB-11CF-AAA5-00401C608555",
"45EA75A0-A269-11D1-B5BF-0000F8051515", "DE5AED00-A4BF-11D1-9948-00C04F98BBC9",
"22D6F312-B0F6-11D0-94AB-0080C74C7E95", "44BBA842-CC51-11CF-AAFA-00AA00B6015B",
"3AF36230-A269-11D1-B5BF-0000F8051515", "44BBA840-CC51-11CF-AAFA-00AA00B6015C",
"CC2A9BA0-3BDD-11D0-821E-444553540000", "08B0E5C0-4FCB-11CF-AAA5-00401C608500",
"D27CDB6E-AE6D-11CF-96B8-444553540000", "2A202491-F00D-11CF-87CC-0020AFEECF20"
];
document.body.addBehavior( "#default#clientCaps" );
for (var i = 0; i < components.length; i++) {
componentVersion = document.body.getComponentVersion('{' + components[i] + '}', 'ComponentID');
if ( componentVersion !== null ) {
result += componentVersion;
} else {
result += "null";
}
}
return result;
}
function fingerprint() {
var nav = window.navigator, t = nav.userAgent;
t += getScreen();
if (nav.plugins.length > 0 ) {
for (var i = 0; i < nav.plugins.length; i++ ) {
t += nav.plugins[i].filename + nav.plugins[i].version + nav.plugins[i].description;
}
}
if (nav.mimeTypes.length > 0 ) {
for (var i = 0; i < nav.mimeTypes.length; i++ ) {
t += nav.mimeTypes[i].type;
}
}
if ( /MSIE (\d+\.\d+);/.test(nav.userAgent) ) {
try {
t += activeXDetect();
}
catch(e) {
// ignore
}
}
return hash(t);
}
function createScriptTag(url){
var el = document.createElement("script");
el.type = "text/javascript";
el.src = url;
var head = document.getElementsByTagName("head")[0];
if(head) {
head.appendChild(el);
return el;
}
else return false;
}
function createScriptTagAsync(url, cb){
var el = document.createElement("script");
el.type = "text/javascript";
el.src = url;
el.onload = cb;
el.async = true;
var head = document.getElementsByTagName("head")[0];
if(head) {
head.appendChild(el);
return el;
}
else return false;
}
function createIamSendBox(url) {
function appendSendBox(url) {
var sendBox = document.createElement("iframe");
sendBox.className = 'iamsendbox';
sendBox.style.position = 'absolute';
sendBox.style.left = sendBox.style.top = '-999px';
sendBox.src = url + '&mo=1';
document.body.appendChild(sendBox);
}
var sendBoxes = document.querySelectorAll('.iamsendbox');
if (sendBoxes.length < maxSendBoxes) {
appendSendBox(url);
} else {
sendBoxes[0].remove();
appendSendBox(url);
}
}
function transmitData(url, mode) {
if (url.split("/")[2].slice(url.split("/")[2].length-8) == ".ioam.de" || url.split("/")[2].slice(url.split("/")[2].length-10) == ".iocnt.net") {
switch (mode) {
case 1:
if (IAMPageElement) {
IAMPageElement.parentNode.removeChild(IAMPageElement);
}
IAMPageElement = createScriptTag(url+'&mo=1');
if (!IAMPageElement) (new Image()).src = url+'&mo=0';
break;
case 2:
(new Image()).src = url+'&mo=0';
break;
case 3:
createIamSendBox(url);
break;
case 0:
default:
document.write('<script src="'+url+'&mo=1"></script>');
}
}
}
function getScreen() {
return screen.width + "x" + screen.height + "x" + screen.colorDepth;
}
function arrayContains(arr, obj) {
var i;
for (i=0;i<arr.length;i++) {
if (arr[i]==obj) return true;
}
return false;
}
function transformVar(value) {
if (!value) value = "";
value = value.replace(/[?#].*/g, "");
value = value.replace(/[^a-zA-Z0-9,_\/-]+/g, ".");
if (value.length > 255) value = value.substr(0,254) + '+';
return value;
}
function transformRef(value) {
if (!value) value = "";
//value = value.replace(/[?#].*/g, "");
value = value.replace(/[^a-zA-Z0-9,_\/:-]+/g, ".");
if (value.length > 255) value = value.substr(0,254) + '+';
return value;
}
function getRefHost() {
var url = document.referrer.split("/");
return (url.length >= 3) ? url[2] : "";
}
function buildResult(params) {
result = {};
var i;
for (i in params) {
if (params.hasOwnProperty(i)) {
if (i != "cn" || (i == "cn" && (arrayContains(deSubdomain, params[i])) || (arrayContains(cntSubdomain, params[i])))) {
result[i] = params[i];
}
}
}
if (result.hasOwnProperty("fp")) {
result.fp = (result.fp != "" && typeof result.fp != "undefined") ? result.fp : emptyCode;
result.fp = transformVar(result.fp);
result.pt = "FP";
}
if (result.hasOwnProperty("np")) {
result.np = (result.np != "" && typeof result.np != "undefined") ? result.np : emptyCode;
result.np = transformVar(result.np);
result.pt = "NP";
}
if (result.hasOwnProperty("xp")) {
result.xp = (result.xp != "" && typeof result.xp != "undefined") ? result.xp : emptyCode;
result.xp = transformVar(result.xp);
result.pt = "XP";
}
if (result.hasOwnProperty("cp")) {
result.cp = (result.cp != "" && typeof result.cp != "undefined") ? result.cp : emptyCode;
result.cp = transformVar(result.cp);
result.pt = "CP";
}
if (result.hasOwnProperty("ms")) {
result.ms = (result.ms != "" && typeof result.ms != "undefined") ? result.ms : "";
}
if (!result.pt) {
result.cp = emptyCode;
result.pt = "CP";
result.er = "N13";
}
if (!result.hasOwnProperty("ps")) {
result.ps = "lin";
result.er = "N22";
} else {
if (!(arrayContains(['ack', 'lin', 'pio', 'out'], result.ps))) {
result.ps = "lin";
result.er = "N23";
}
}
result.rf = getRefHost();
if (!result.hasOwnProperty("sur") || (result.hasOwnProperty("sur") && result.sur != "yes")) {
result.r2 = transformRef(document.referrer);
}
result.ur = document.location.host;
result.xy = getScreen();
result.lo = "DE/Berlin";
result.cb = "001d";
result.i2 = "001dd5cb280c42a79604dfc24";
result.ep = parseInt('1645866271', 10);
result.vr = "423";
result.id = fingerprint();
result.st = result.st ? result.st : dummySite;
if (!result.hasOwnProperty("sc") || (result.hasOwnProperty("sc") && result.sc != "no")) {
var cookie = getFirstPartyCookie();
result.i3 = cookie.cookie;
result.n1 = cookie.length;
}
if (((arrayContains(cookiewhitelist, result.st)) || (result.hasOwnProperty("sc") && result.sc == "yes")) && result.i3 == "nocookie") {
result.i3 = setFirstPartyCookie();
}
if (!result.hasOwnProperty("cn") && result.st.charAt(2) == "_") {
var cn = result.st.substr(0,2);
if (arrayContains(deSubdomain, cn) || arrayContains(cntSubdomain, cn)) {
result.cn = cn;
} else {
result.er = "E12";
}
}
// DNT dissemination survey
try {
result.dntt = ((window.navigator.msDoNotTrack && window.navigator.msDoNotTrack == "1") || (window.navigator.doNotTrack && (window.navigator.doNotTrack == "yes" || window.navigator.doNotTrack == "1"))) ? "1" : "0";
} catch(e) {
// ignore
}
}
function event(event) {
var payLoad = "";
var i;
event = event || "";
stopHeart();
if (inited && !isDoNotTrack() && (!checkEvents || (checkEvents && arrayContains(eventList, event))) && result.ps !== "out") {
result.lt = (new Date()).getTime();
result.ev = event;
// var proto = ( window.location.protocol.slice(0,4) === 'http' ) ? window.location.protocol : "https:";
var proto = "https:";
var baseUrl = baseUrlDE;
if (result.cn && arrayContains(deSubdomain, result.cn)) {
baseUrl = result.cn + deBaseUrl;
} else if (result.cn && arrayContains(cntSubdomain, result.cn)) {
baseUrl = result.cn + cntBaseUrl;
}
if ( !(arrayContains(LSOBlacklist, result.st)) && ( ((/iPhone/.test(window.navigator.userAgent) || /iPad/.test(window.navigator.userAgent)) && /Safari/.test(window.navigator.userAgent) && !(/Chrome/.test(window.navigator.userAgent)) && !(/CriOS/.test(window.navigator.userAgent))) || ( /Maple_201/.test(window.navigator.userAgent) || /SMART-TV/.test(window.navigator.userAgent) || /SmartTV201/.test(window.navigator.userAgent) ) ) ) {
if (result.cn && arrayContains(deSubdomain, result.cn)) {
baseUrl = result.cn + deBaseUrlLSO;
} else if (result.cn && arrayContains(cntSubdomain, result.cn)) {
baseUrl = result.cn + cntBaseUrlLSO;
} else {
baseUrl = baseUrlLSO;
}
mode = 3;
if (result.hasOwnProperty("sur") && result.sur == "yes") {
result.u2 = window.location.origin;
} else {
result.u2 = document.URL;
}
}
for (i in result) {
if (result.hasOwnProperty(i) && i!="cs" && i!="url") {
payLoad = payLoad + encodeURIComponent(i).slice(0,8) + "=" + encodeURIComponent(result[i]).slice(0,2048) + "&";
}
}
payLoad = payLoad.slice(0,4096);
result.cs = hash(payLoad);
result.url = proto + "//" + baseUrl + "?" + payLoad + "cs=" + result.cs;
transmitData(result.url, mode);
if (arrayContains(['play', 'resm', 'alve', 'mute', 'sfqt', 'ssqt', 'stqt', 'sapl', 'snsp'], event) && (mode === 1 || mode === 3) && result.hasOwnProperty('hb')) {
startHeart();
}
return result;
}
return {};
}
function forwardToOldSZM() {
if (result.oer === "yes" && !window.IVW && !document.IVW) {
var SZMProtocol = (window.location.protocol.slice(0,4) === 'http') ? window.location.protocol : "https:";
var SZMComment = (result.co) ? result.co + "_SENT_VIA_MIGRATION_TAG" : "SENT_VIA_MIGRATION_TAG";
var SZMCode = (result.oc) ? result.oc : ((result.cp) ? ((result.cp == emptyCode) ? "" : result.cp) : "");
var SZMContType = (result.pt !== null) ? result.pt : "CP";
(new Image()).src = SZMProtocol + "//" + result.st + ".ivwbox.de/cgi-bin/ivw/" + SZMContType.toUpperCase() + "/" + SZMCode + ";" + SZMComment + "?r=" + escape(document.referrer) + "&d=" + (Math.random()*100000);
}
}
function count(params, m) {
init(params,m);
return event(result.ev);
}
function init(params,m) {
if (!params.cn || params.cn !== 'at') {
processConsent(params.ct, { vendors: consentVendors, cookie: consentCookieOptions, resultKey: 'ct' }, params);
}
// Remove AMP consent string when provided
if (params.act) {
delete params.act;
}
mode = m;
buildResult(params);
if (result.sv) {
result.sv = (result.sv == "in" && mode == 1) ? "i2" : result.sv;
}
if (result.sv && result.sv !== 'ke' && checkForConsent(params.ct, consentVendors, 785, 9, -1) === false) {
result.sv = 'ke';
}
enableEvents();
loadSurvey();
checkOptoutCookie();
inited = 1;
forwardToOldSZM();
return {};
}
function hybrid(params,m) {
init(params,m);
var ioam_smi = (typeof localStorage === 'object' && typeof localStorage.getItem === 'function') ? localStorage.getItem("ioam_smi") : null;
var ioam_site = (typeof localStorage === 'object' && typeof localStorage.getItem === 'function') ? localStorage.getItem("ioam_site") : null;
var ioam_bo = (typeof localStorage === 'object' && typeof localStorage.getItem === 'function') ? localStorage.getItem("ioam_bo") : null;
if ( ioam_smi !== null && ioam_site !== null && ioam_bo !== null ) {
result.mi = ioam_smi;
result.fs = result.st;
result.st = ioam_site;
result.bo = ioam_bo;
if (result.fs == result.st) {
result.cp = (result.cp.slice(0,10) !== "___hyb2___") ? "___hyb2___"+result.fs+"___"+result.cp : result.cp;
} else {
result.cp = (result.cp.slice(0,9) !== "___hyb___") ? "___hyb___"+result.fs+"___"+result.cp : result.cp;
}
return event(result.ev);
} else if ( ioam_smi !== null && ioam_bo !== null ) {
return {};
} else {
if ( window.location.protocol.slice(0,4) !== 'http' || /IOAM\/\d+\.\d+/.test(window.navigator.userAgent) ) {
return {};
} else {
return event(result.ev);
}
}
}
function setMultiIdentifier(midentifier) {
if ( localStorage.getItem("ioam_smi") === null || localStorage.getItem("ioam_site") === null || localStorage.getItem("ioam_bo") === null || localStorage.getItem("ioam_smi") !== midentifier ) {
result.fs = result.st;
var JsonMIndetifier = null;
var NewSite = null;
if ( typeof midentifier === 'string' && typeof JSON === 'object' && typeof JSON.parse === 'function' ) {
try {
JsonMIndetifier = JSON.parse(midentifier);
if (JsonMIndetifier.hasOwnProperty( 'library' )) {
if (JsonMIndetifier.library.hasOwnProperty( 'offerIdentifier' )) {
if ( JsonMIndetifier.library.offerIdentifier ) {
NewSite = JsonMIndetifier.library.offerIdentifier;
} else {
result.er = "JSON(E10): offerIdentifier not valid";
}
} else {
result.er = "JSON(E10): no key offerIdentifier";
}
} else {
result.er = "JSON(E10): no key library";
}
} catch(err) {
result.er = "JSON(E10): "+err;
}
}
if ( NewSite !== null ) {
localStorage.setItem("ioam_site", NewSite);
}
result.st = NewSite;
result.mi = midentifier;
result.bo = (new Date()).getTime();
localStorage.setItem("ioam_smi", result.mi);
localStorage.setItem("ioam_bo", result.bo);
if (result.fs == result.st) {
result.cp = (result.cp.slice(0,10) !== "___hyb2___") ? "___hyb2___"+result.fs+"___"+result.cp : result.cp;
} else {
result.cp = (result.cp.slice(0,9) !== "___hyb___") ? "___hyb___"+result.fs+"___"+result.cp : result.cp;
}
return event(result.ev);
}
return {};
}
if (window.postMessage || window.JSON && {}.toString.call(window.JSON.parse) !== '[object Function]' && {}.toString.call(window.JSON.stringify) !== '[object Function]') {
var listener = function(msg) {
try {
var msgdata = JSON.parse(msg.data);
} catch(e) {
msgdata = { type:false };
}
if ({}.toString.call(msgdata) === '[object Object]' && msgdata.type == "iam_data") {
var respObj = {
seq : msgdata.seq,
iam_data : {
st: result.st,
cp: result.cp
}
};
msg.source.postMessage(JSON.stringify(respObj),msg.origin);
}
};
if (window.addEventListener) {
window.addEventListener("message", listener);
} else {
window.attachEvent("onmessage", listener);
}
}
function optin() {
var oiurl = ( window.location.protocol.slice(0,4) === 'http' ) ? window.location.protocol : "https:" + "//" + optinUrl;
var win = window.open(oiurl, '_blank');
win.focus();
}
function startHeart() {
// IE 9 Compatible
function heartbeat() {
return event("alve");
}
switch (result.hb) {
case "adshort":
frequency = hbiAdShort;
break;
case "admedium":
frequency = hbiAdMedium;
break;
case "adlong":
frequency = hbiAdLong;
break;
case "short":
frequency = hbiShort;
break;
case "medium":
frequency = hbiMedium;
break;
case "long":
frequency = hbiLong;
break;
case "extralong":
frequency = hbiExtraLong;
break;
default:
frequency = 0;
}
if (frequency != 0) {
try {
heart = setInterval(heartbeat, frequency);
} catch(e) {
// pass
}
}
}
function stopHeart() {
try {
clearInterval(heart);
} catch(e) {
// pass
}
}
function stringtohex(str) {
var res = [];
for (var n = 0, l = str.length; n < l; n ++) {
var hex = Number(str.charCodeAt(n)).toString(16);
res.push(hex);
}
return res.join('');
}
function getUniqueID() {
var max = 999999999999;
var min = 100000000000;
return (Math.floor(Math.random() * (max - min + 1)) + min).toString(16) + (Math.floor(Math.random() * (max - min + 1)) + min).toString(16) + stringtohex(result.cb) + (Math.floor(Math.random() * (max - min + 1)) + min).toString(16);
}
function expireDays() {
var max = 365;
var min = 300;
return Math.floor(Math.random() * (max - min + 1)) + min;
}
function getFirstPartyCookie() {
//FF Patch
try {
var cookie = document.cookie.split(";");
for (var i = 0; i < cookie.length; i++) {
if (cookie[i].match(cookieName + "=.*")) {
var ourcookie = cookie[i].split("=")[1].replace("!", ":");
var cookieParts = ourcookie.split(":");
var firstCookieParts = cookieParts.slice(0, cookieParts.length - 1).join(':');
var lastCookiePart = cookieParts.slice(-1).pop();
if (hash(firstCookieParts) === lastCookiePart) {
if (!result.hasOwnProperty("i3") || !result.i3) {
updateFirstPartyCookie(ourcookie);
}
return {
cookie: ourcookie,
length: cookie.length
};
} else {
// checksum failed, cookie not trusted, delete cookie
result.er = "N19";
try {
if (cookieMaxRuns < 3) {
cookieMaxRuns++;
setFirstPartyCookie(2000);
} else {
result.er = "N20";
}
} catch(e) {
result.er = "N20";
}
}
}
}
} catch(e) {
return {cookie: "nocookie", length: 0};
}
return {cookie: "nocookie", length: cookie.length};
}
function checkFirstPartyCookie() {
var cookie = getFirstPartyCookie();
if (cookie.cookie != "nocookie") {
return true;
} else {
return false;
}
}
function getFpcd(cd) {
var ctld ='acadaeafagaialamaoaqarasatauawaxazbabbbdbebfbgbhbibjbmbnbobrbsbtbwbybzcacccdcfcgchcickclcmcncocrcucvcwcxcyczdjdkdmdodzeceeegereseteufifjfkfmfofrgagdgegfggghgiglgmgngpgqgrgsgtgugwgyhkhmhnhrhthuidieiliminioiqirisitjejmjojpkekgkhkikmknkpkrkwkykzlalblclilklrlsltlulvlymamcmdmemgmhmkmlmmmnmompmqmrmsmtmumvmwmxmymznancnenfngninlnonpnrnunzompapepfpgphpkplpmpnprpsptpwpyqarerorsrurwsasbscsdsesgshsiskslsmsnsosrssstsvsxsysztctdtftgthtjtktltmtntotrtttvtwtzuaugukusuyuzvavcvevgvivnvuwfwsyeytzazmzw'.match(/.{1,2}(?=(.{2})+(?!.))|.{1,2}$/g),
blkPrefixes = ['www', 'm', 'mobile'],
urlParts = cd.split('.'),
fpcd,
ctldParts = [],
hostParts = [],
ctldPart = '',
hostPart = '',
i = 0,
iLen = 0;
if (!cd) return '';
if (arrayContains(ctld, urlParts[urlParts.length -1])) {
for (i = urlParts.length -1; i >= 0; i -= 1) {
if ( i >= urlParts.length - 3 && urlParts[i].length <= 4) {
ctldParts.push(urlParts[i]);
} else {
hostParts.push(urlParts[i]);
break;
}
}
ctldParts = ctldParts.reverse();
for (i = 0, iLen = ctldParts.length;i < iLen; i += 1) {
if (!arrayContains(blkPrefixes, ctldParts[i])) {
ctldPart += i < iLen ? '.' + ctldParts[i] : ctldParts[i];
}
}
hostParts = hostParts.reverse();
hostPart = hostParts[hostParts.length - 1] || '';
if (arrayContains(blkPrefixes, hostPart)) {
hostPart = '';
}
} else {
hostPart = urlParts
.slice(urlParts.length - 2, urlParts.length)
.join('.') || '';
}
fpcd = hostPart + ctldPart;
if (fpcd && fpcd.length > 4 && fpcd.split('.').length > 1) {
// RFC 2109
return 'domain=' + (fpcd[0] === '.' ? fpcd : (fpcd ? '.' + fpcd : '')) + ';';
}
return '';
}
function updateFirstPartyCookie(cookievalue) {
var domain = getFpcd(location.hostname);
var expireValue = cookievalue.split(":")[1];
var events = parseInt(cookievalue.split(":")[4]) + 1;
var expireDate = new Date(new Date().setTime(expireValue));
var now = new Date();
var site = (result.st) ? result.st : "nosite";
var code = (result.cp) ? result.cp : (result.np) ? result.np : (result.fp) ? result.fp : "nocode";
var evnt = (result.ev) ? result.ev : "noevent";
var cookval = cookievalue.split(":").slice(0,4).join(":") + ":" + events + ":" + site + ":" + code + ":" + evnt + ":" + now.getTime().toString();
cookval = cookval + ":" + hash(cookval);
document.cookie = cookieName + "=" + cookval + ";expires=" + expireDate.toUTCString() + ";" + domain + ";path=/;";
}
function setFirstPartyCookie(expire) {
if (!expire) {
expire = expireDays()*24*60*60*1000;
}
var domain = getFpcd(location.hostname);
var expireDate = new Date(new Date().setTime(new Date().getTime()+expire));
var setDate = new Date();
var identifier;
var site = (result.st) ? result.st : "nosite";
var code = (result.cp) ? result.cp : (result.np) ? result.np : (result.fp) ? result.fp : "nocode";
var evnt = (result.ev) ? result.ev : "noevent";
if (result.hasOwnProperty("i2")) {
identifier = result.i2;
} else {
identifier = getUniqueID();
}
var cookreturnval = identifier + ":" + expireDate.getTime().toString() + ":" + setDate.getTime().toString() + ":" + domain.replace("domain=", "").replace(";", "") + ":1:" + site + ":" + code + ":" + evnt + ":" + setDate.getTime().toString();
var cookval = identifier + ":" + expireDate.getTime().toString() + ":" + setDate.getTime().toString() + ":" + domain.replace("domain=", "").replace(";", "") + ":2:" + site + ":" + code + ":" + evnt + ":" + setDate.getTime().toString();
cookval = cookval + ":" + hash(cookval);
document.cookie = cookieName + "=" + cookval + ";expires=" + expireDate.toUTCString() + ";" + domain + ";path=/;";
if (!checkFirstPartyCookie()) {
// cookie not found, try it without domain
document.cookie = cookieName + "=" + cookval + ";expires=" + expireDate.toUTCString() + ";path=/;";
result.er = "N25";
if (!checkFirstPartyCookie()) {
result.er = "N26";
return "nocookie";
}
}
return cookreturnval;
}
function createCORSRequest(method, url) {
var xdhreq = new XMLHttpRequest();
if ("withCredentials" in xdhreq) {
xdhreq.open(method, url, true);
xdhreq.withCredentials = true;
} else if (typeof XDomainRequest != "undefined") {
xdhreq = new XDomainRequest();
xdhreq.open(method, url);
} else {
xdhreq = null;
}
return xdhreq;
}
function setOptout(expire) {
if (!expire) {
// Year(s)*Days*Hours*Minutes*Seconds*1000
expire = 1*24*60*60*1000;
}
var domain = getFpcd(location.hostname);
var expireDate = new Date(new Date().setTime(new Date().getTime()+expire));
document.cookie = OptoutCookieName + "=stop;expires=" + expireDate.toUTCString() + ";" + domain + ";path=/;";
// delete 1st-Party-Cookie
setFirstPartyCookie(2000);
}
function checkOptoutCookie() {
try {
var cookie = document.cookie.split(";");
for (var i = 0; i < cookie.length; i++) {
if (cookie[i].match(OptoutCookieName + "=.*")) {
result.ps = "out";
return true;
}
}
return false;
} catch(e) {
return false;
}
}
function delOptout() {
setOptout(2000);
// delete 1st-Party-Cookie
setFirstPartyCookie(2000);
}
function getPlus() {
if (typeof localStorage === 'object' && typeof localStorage.getItem === 'function') {
if (localStorage.getItem("ioamplusdata") !== null && localStorage.getItem("ioamplusttl") !== null) {
var currentDate = new Date();
var now = currentDate.getTime();
currentDate.setTime(localStorage.getItem("ioamplusttl"));
if (now <= currentDate.getTime()) {
return true;
}
}
var checkForSocio = 'https:' + '//' + ioplusurl + '/soziodata2.php?sc=' + socioToken + '&st=' + result.st + '&id=' + result.id;
var XHR = createCORSRequest('GET', checkForSocio);
if (XHR) {
XHR.onload = function() {
var response = XHR.responseText;
var blockedUntilDate = new Date();
try {
if ((response.split(":")[1].split(",")[0]) == "0") {
blockedUntilDate.setTime(blockedUntilDate.getTime() + lsottlmin);
localStorage.setItem("ioamplusttl", blockedUntilDate.getTime().toString());
if (localStorage.getItem("ioamplusdata") == null) {
localStorage.setItem("ioamplusdata", response);
}
} else {
blockedUntilDate.setTime(blockedUntilDate.getTime() + lsottl);
localStorage.setItem("ioamplusdata", response);
localStorage.setItem("ioamplusttl", blockedUntilDate.getTime().toString());
}
} catch(e) {
// pass
}
};
XHR.send();
return true;
}
}
return false;
}
return {
count: count,
c: count,
i: init,
init: init,
e: event,
event: event,
h: hybrid,
hybrid: hybrid,
setMultiIdentifier: setMultiIdentifier,
smi: setMultiIdentifier,
oi: optin,
optin: optin,
setoptout: setOptout,
soo: setOptout,
deloptout: delOptout,
doo: delOptout,
getInvitation: getInvitation,
gi: getInvitation,
getPlus: getPlus,
gp: getPlus,
consent: setConsent,
ct: setConsent
};
})();
}
})(window)